apelin-36   Click here for help

GtoPdb Ligand ID: 3555

Comment: Rat and mouse sequences are identical
Species: Mouse, Rat
Peptide Sequence Click here for help
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Leu-Val-Lys-Pro-Arg-Thr-Ser-Arg-Thr-Gly-Pro-Gly-Ala-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe