Synonyms: big gastrin
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Sulfated form of gastrin-34.
Species: Human
View more information in the IUPHAR Pharmacology Education Project: gastrin-34 |
Peptide Sequence | |
XLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF | |
pGlu-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tys-Gly-Trp-Met-Asp-Phe-NH2 |
Post-translational Modification | |
The N-terminal glutamic acid cyclizes into pyroglutamic acid (represented by pGlu and X), the tyrosine residue at position 29 is sulfated (represented by Tys) and the C-terminal phenylalanine is amidated. |