C5a   

GtoPdb Ligand ID: 3577

Synonyms: C5a anaphylatoxin | complement component C5a
Species: Rat
Peptide Sequence
DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR
Asp-Leu-Gln-Leu-Leu-His-Gln-Lys-Val-Glu-Glu-Gln-Ala-Ala-Lys-Tyr-Lys-His-Arg-Val-Pro-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Arg-Glu-Asn-Lys-Tyr-Glu-Thr-Cys-Glu-Gln-Arg-Val-Ala-Arg-Val-Thr-Ile-Gly-Pro-His-Cys-Ile-Arg-Ala-Phe-Asn-Glu-Cys-Cys-Thr-Ile-Ala-Asp-Lys-Ile-Arg-Lys-Glu-Ser-His-His-Lys-Gly-Met-Leu-Leu-Gly-Arg