|
Abbreviated name: CT
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The genes encoding mouse and rat calcitonin respectively also encodes two other isoforms: katacalcin and α-CGRP. Mouse and rat α-CGRP is represented by α-CGRP.
Species: Mouse, Rat
|
Peptide Sequence  |
|
| CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP | |
| Cys-Gly-(GlcNAc)Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Glu-Ala-Pro-NH2 | |
| Post-translational Modification | |
| The C-terminal proline is amidated into Pro-NH2, a disulphide bridge is formed between the cysteine residues at positions 1 and 7 and the asparagine residue at position 3 is N-linked glycosylated. | |
