GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

C3a   Click here for help

GtoPdb Ligand ID: 3641

Synonyms: C3a anaphylatoxin | complement component C3a
Species: Mouse
Peptide Sequence Click here for help
SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR
Ser-Val-Gln-Leu-Met-Glu-Arg-Arg-Met-Asp-Lys-Ala-Gly-Gln-Tyr-Thr-Asp-Lys-Gly-Leu-Arg-Lys-Cys-Cys-Glu-Asp-Gly-Met-Arg-Asp-Ile-Pro-Met-Arg-Tyr-Ser-Cys-Gln-Arg-Arg-Ala-Arg-Leu-Ile-Thr-Gln-Gly-Glu-Asn-Cys-Ile-Lys-Ala-Phe-Ile-Asp-Cys-Cys-Asn-His-Ile-Thr-Lys-Leu-Arg-Glu-Gln-His-Arg-Arg-Asp-His-Val-Leu-Gly-Leu-Ala-Arg
Post-translational Modification
There are 3 disulfide bonds formed between Cysteine residues at positions 23 and 50, 24 and 57, 37 and 58.