Wnt-1   

GtoPdb Ligand ID: 3672

Species: Human
Peptide Sequence
ANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTA
PGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDS
GEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRAS
RAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNC
TFHWCCHVSCRNCTHTRVLHECL
Ala-Asn-Ser-Ser-Gly-Arg-Trp-Trp-Gly-Ile-Val-Asn-Val-Ala-Ser-Ser-Thr-Asn-Leu-Leu-Thr-Asp-Ser-Lys-Ser-Leu-Gln-Leu-Val-Leu-Glu-Pro-Ser-Leu-Gln-Leu-Leu-Ser-Arg-Lys-Gln-Arg-Arg-Leu-Ile-Arg-Gln-Asn-Pro-Gly-Ile-Leu-His-Ser-Val-Ser-Gly-Gly-Leu-Gln-Ser-Ala-Val-Arg-Glu-Cys-Lys-Trp-Gln-Phe-Arg-Asn-Arg-Arg-Trp-Asn-Cys-Pro-Thr-Ala-Pro-Gly-Pro-His-Leu-Phe-Gly-Lys-Ile-Val-Asn-Arg-Gly-Cys-Arg-Glu-Thr-Ala-Phe-Ile-Phe-Ala-Ile-Thr-Ser-Ala-Gly-Val-Thr-His-Ser-Val-Ala-Arg-Ser-Cys-Ser-Glu-Gly-Ser-Ile-Glu-Ser-Cys-Thr-Cys-Asp-Tyr-Arg-Arg-Arg-Gly-Pro-Gly-Gly-Pro-Asp-Trp-His-Trp-Gly-Gly-Cys-Ser-Asp-Asn-Ile-Asp-Phe-Gly-Arg-Leu-Phe-Gly-Arg-Glu-Phe-Val-Asp-Ser-Gly-Glu-Lys-Gly-Arg-Asp-Leu-Arg-Phe-Leu-Met-Asn-Leu-His-Asn-Asn-Glu-Ala-Gly-Arg-Thr-Thr-Val-Phe-Ser-Glu-Met-Arg-Gln-Glu-Cys-Lys-Cys-His-Gly-Met-Ser-Gly-Ser-Cys-Thr-Val-Arg-Thr-Cys-Trp-Met-Arg-Leu-Pro-Thr-Leu-Arg-Ala-Val-Gly-Asp-Val-Leu-Arg-Asp-Arg-Phe-Asp-Gly-Ala-Ser-Arg-Val-Leu-Tyr-Gly-Asn-Arg-Gly-Ser-Asn-Arg-Ala-Ser-Arg-Ala-Glu-Leu-Leu-Arg-Leu-Glu-Pro-Glu-Asp-Pro-Ala-His-Lys-Pro-Pro-Ser-Pro-His-Asp-Leu-Val-Tyr-Phe-Glu-Lys-Ser-Pro-Asn-Phe-Cys-Thr-Tyr-Ser-Gly-Arg-Leu-Gly-Thr-Ala-Gly-Thr-Ala-Gly-Arg-Ala-Cys-Asn-Ser-Ser-Ser-Pro-Ala-Leu-Asp-Gly-Cys-Glu-Leu-Leu-Cys-Cys-Gly-Arg-Gly-His-Arg-Thr-Arg-Thr-Gln-Arg-Val-Thr-Glu-Arg-Cys-Asn-Cys-Thr-Phe-His-Trp-Cys-Cys-His-Val-Ser-Cys-Arg-Asn-Cys-Thr-His-Thr-Arg-Val-Leu-His-Glu-Cys-Leu
Post-translational Modification
Residues at positions 2, 289, 319 and 332 are N-linked glycosylated