GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

prokineticin-1   Click here for help

GtoPdb Ligand ID: 3715

Synonyms: endocrine gland vascular endothelial growth factor | prokineticin 1
Species: Mouse
Peptide Sequence Click here for help
AVITGACERDIQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFLRKRQHHTCPCSPSLLCSRFPDGRYRCFRD
LKNANF
Ala-Val-Ile-Thr-Gly-Ala-Cys-Glu-Arg-Asp-Ile-Gln-Cys-Gly-Ala-Gly-Thr-Cys-Cys-Ala-Ile-Ser-Leu-Trp-Leu-Arg-Gly-Leu-Arg-Leu-Cys-Thr-Pro-Leu-Gly-Arg-Glu-Gly-Glu-Glu-Cys-His-Pro-Gly-Ser-His-Lys-Ile-Pro-Phe-Leu-Arg-Lys-Arg-Gln-His-His-Thr-Cys-Pro-Cys-Ser-Pro-Ser-Leu-Leu-Cys-Ser-Arg-Phe-Pro-Asp-Gly-Arg-Tyr-Arg-Cys-Phe-Arg-Asp-Leu-Lys-Asn-Ala-Asn-Phe
Post-translational Modification
There are 5 disulfide bonds formed between cysteine residues at positions 7 and 19, 13 and 31, 18 and 59, 41 and 67, 61 and 77.