adiponectin   

GtoPdb Ligand ID: 3726

Synonyms: flAdipo
Species: Human
Peptide Sequence
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQ
GRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKK
DKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Glu-Thr-Thr-Thr-Gln-Gly-Pro-Gly-Val-Leu-Leu-Pro-Leu-Pro-Lys-Gly-Ala-Cys-Thr-Gly-Trp-Met-Ala-Gly-Ile-Pro-Gly-His-Pro-Gly-His-Asn-Gly-Ala-Pro-Gly-Arg-Asp-Gly-Arg-Asp-Gly-Thr-Pro-Gly-Glu-Lys-Gly-Glu-Lys-Gly-Asp-Pro-Gly-Leu-Ile-Gly-Pro-Lys-Gly-Asp-Ile-Gly-Glu-Thr-Gly-Val-Pro-Gly-Ala-Glu-Gly-Pro-Arg-Gly-Phe-Pro-Gly-Ile-Gln-Gly-Arg-Lys-Gly-Glu-Pro-Gly-Glu-Gly-Ala-Tyr-Val-Tyr-Arg-Ser-Ala-Phe-Ser-Val-Gly-Leu-Glu-Thr-Tyr-Val-Thr-Ile-Pro-Asn-Met-Pro-Ile-Arg-Phe-Thr-Lys-Ile-Phe-Tyr-Asn-Gln-Gln-Asn-His-Tyr-Asp-Gly-Ser-Thr-Gly-Lys-Phe-His-Cys-Asn-Ile-Pro-Gly-Leu-Tyr-Tyr-Phe-Ala-Tyr-His-Ile-Thr-Val-Tyr-Met-Lys-Asp-Val-Lys-Val-Ser-Leu-Phe-Lys-Lys-Asp-Lys-Ala-Met-Leu-Phe-Thr-Tyr-Asp-Gln-Tyr-Gln-Glu-Asn-Asn-Val-Asp-Gln-Ala-Ser-Gly-Ser-Val-Leu-Leu-His-Leu-Glu-Val-Gly-Asp-Gln-Val-Trp-Leu-Gln-Val-Tyr-Gly-Glu-Gly-Glu-Arg-Asn-Gly-Leu-Tyr-Ala-Asp-Asn-Asp-Asn-Asp-Ser-Thr-Phe-Thr-Gly-Phe-Leu-Leu-Tyr-His-Asp-Thr-Asn