glycoprotein hormone common alpha subunit

Ligand id: 3731

Name: glycoprotein hormone common alpha subunit

Species: Human

Is a component of
Peptide Sequence
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT
ACHCSTCYYHKS
Ala-Pro-Asp-Val-Gln-Asp-Cys-Pro-Glu-Cys-Thr-Leu-Gln-Glu-Asn-Pro-Phe-Phe-Ser-Gln-Pro-Gly-Ala-Pro-Ile-Leu-Gln-Cys-Met-Gly-Cys-Cys-Phe-Ser-Arg-Ala-Tyr-Pro-Thr-Pro-Leu-Arg-Ser-Lys-Lys-Thr-Met-Leu-Val-Gln-Lys-Asn-Val-Thr-Ser-Glu-Ser-Thr-Cys-Cys-Val-Ala-Lys-Ser-Tyr-Asn-Arg-Val-Thr-Val-Met-Gly-Gly-Phe-Lys-Val-Glu-Asn-His-Thr-Ala-Cys-His-Cys-Ser-Thr-Cys-Tyr-Tyr-His-Lys-Ser
Post-translational Modification
The production of biologically active FSH, LH and TSH requires the FSHβ, LHβ and TSHβ subunits and the common α subunits to assemble to form the heterodimeric hormone. The common α subunit is glycosylated at asparagines 52 and 78, and disulfide bond formation occurs between cysteine residues at positions 7 and 31; 10 and 60; 28 and 82; 32 and 84 and 59 and 87. It then assembles with the various β subunits to form the biologically active FSH, LH and TSH heterodimers.