relaxin-1 (B chain)   Click here for help

GtoPdb Ligand ID: 3743

Synonyms: H1 relaxin (B chain)
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Is a component of
relaxin-1
Peptide Sequence Click here for help
VAAKWKDDVIKLCGRELVRAQIAICGMSTWS
Val-Ala-Ala-Lys-Trp-Lys-Asp-Asp-Val-Ile-Lys-Leu-Cys-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Cys-Gly-Met-Ser-Thr-Trp-Ser
Post-translational Modification
Fully active H1 relaxin is a heterodimer of the B chain and the A chain linked by two disulfide bonds, the first between B chain (residue 35) and A chain (residue 172), and the second between B chain (residue 47) and A chain (residue 185).