GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: insulin-like peptide 3 B chain
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Is a component of |
INSL3 |
Peptide Sequence ![]() |
|
PTPEMREKLCGHHFVRALVRVCGGPRWSTEA | |
Pro-Thr-Pro-Glu-Met-Arg-Glu-Lys-Leu-Cys-Gly-His-His-Phe-Val-Arg-Ala-Leu-Val-Arg-Val-Cys-Gly-Gly-Pro-Arg-Trp-Ser-Thr-Glu-Ala |
Post-translational Modification | |
Fully active INSL3 is a heterodimer of the B chain and the A chain linked by two disulfide bonds, the first between B chain (residue 34) and A chain (residue 116), and the second between B chain (residue 46) and A chain (residue 129). |