[125I]CT (human)   Click here for help

GtoPdb Ligand ID: 3776

Synonyms: [125I]-calcitonin (Human) | [125I]-CT (Human)
 Ligand is labelled  Ligand is radioactive
Click here for help
Peptide Sequence Click here for help
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2