CCL18   Click here for help

GtoPdb Ligand ID: 4382

Synonyms: macrophage inflammatory protein 4 | small-inducible cytokine A18
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: CCL18 is a CC family chemokine. There are no rodent homologs of this human chemokine.
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Ala-Gln-Val-Gly-Thr-Asn-Lys-Glu-Leu-Cys-Cys-Leu-Val-Tyr-Thr-Ser-Trp-Gln-Ile-Pro-Gln-Lys-Phe-Ile-Val-Asp-Tyr-Ser-Glu-Thr-Ser-Pro-Gln-Cys-Pro-Lys-Pro-Gly-Val-Ile-Leu-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Ile-Cys-Ala-Asp-Pro-Asn-Lys-Lys-Trp-Val-Gln-Lys-Tyr-Ile-Ser-Asp-Leu-Lys-Leu-Asn-Ala
Post-translational Modification
Disulphide bridges between cysteine residues at positions 30 and 54 and 31 and 70.