GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCL18   Click here for help

GtoPdb Ligand ID: 4382

Synonyms: macrophage inflammatory protein 4 | small-inducible cytokine A18
Immunopharmacology Ligand
Comment: CCL18 is a CC family chemokine. There are no rodent homologs of this human chemokine.
Species: Human
Click here for help
Peptide Sequence Click here for help
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Ala-Gln-Val-Gly-Thr-Asn-Lys-Glu-Leu-Cys-Cys-Leu-Val-Tyr-Thr-Ser-Trp-Gln-Ile-Pro-Gln-Lys-Phe-Ile-Val-Asp-Tyr-Ser-Glu-Thr-Ser-Pro-Gln-Cys-Pro-Lys-Pro-Gly-Val-Ile-Leu-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Ile-Cys-Ala-Asp-Pro-Asn-Lys-Lys-Trp-Val-Gln-Lys-Tyr-Ile-Ser-Asp-Leu-Lys-Leu-Asn-Ala
Post-translational Modification
Disulphide bridges between cysteine residues at positions 30 and 54 and 31 and 70.