TSH β subunit   Click here for help

GtoPdb Ligand ID: 4392

Synonyms: thyrotropin subunit beta | TSH beta subunit | TSHβ | TSH-B
Species: Mouse
Is a component of
Peptide Sequence Click here for help
FCIPTEYTMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVA
VSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY
Phe-Cys-Ile-Pro-Thr-Glu-Tyr-Thr-Met-Tyr-Val-Asp-Arg-Arg-Glu-Cys-Ala-Tyr-Cys-Leu-Thr-Ile-Asn-Thr-Thr-Ile-Cys-Ala-Gly-Tyr-Cys-Met-Thr-Arg-Asp-Ile-Asn-Gly-Lys-Leu-Phe-Leu-Pro-Lys-Tyr-Ala-Leu-Ser-Gln-Asp-Val-Cys-Thr-Tyr-Arg-Asp-Phe-Ile-Tyr-Arg-Thr-Val-Glu-Ile-Pro-Gly-Cys-Pro-His-His-Val-Thr-Pro-Tyr-Phe-Ser-Phe-Pro-Val-Ala-Val-Ser-Cys-Lys-Cys-Gly-Lys-Cys-Asn-Thr-Asp-Asn-Ser-Asp-Cys-Ile-His-Glu-Ala-Val-Arg-Thr-Asn-Tyr-Cys-Thr-Lys-Pro-Gln-Ser-Phe-Tyr
Post-translational Modification
Asparagine residue at position 23 is N-linked glycosylated; disulfide bonds between cysteine residues at position 2 and 52, 16 and 67, 19 and 105, 27 and 83, 31 and 85 and 88 and 95. The production of biologically active TSH requires appropriately folded TSHβ and common α subunits that assemble to form the TSH heterodimer.