CCL1   

GtoPdb Ligand ID: 4404

Comment: This is the mouse homolog of human CCL1.
Species: Mouse
Peptide Sequence
KSMLTVSNSCCLNTLKKELPLKFIQCYRKMGSSCPDPPAVVFRLNKGRESCASTNKTWVQNHLKKVNPC
Lys-Ser-Met-Leu-Thr-Val-Ser-Asn-Ser-Cys-Cys-Leu-Asn-Thr-Leu-Lys-Lys-Glu-Leu-Pro-Leu-Lys-Phe-Ile-Gln-Cys-Tyr-Arg-Lys-Met-Gly-Ser-Ser-Cys-Pro-Asp-Pro-Pro-Ala-Val-Val-Phe-Arg-Leu-Asn-Lys-Gly-Arg-Glu-Ser-Cys-Ala-Ser-Thr-Asn-Lys-Thr-Trp-Val-Gln-Asn-His-Leu-Lys-Lys-Val-Asn-Pro-Cys