CCL2

Ligand id: 4407

Name: CCL2

Species: Rat

Peptide Sequence
QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFY
KIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
Gln-Pro-Asp-Ala-Val-Asn-Ala-Pro-Leu-Thr-Cys-Cys-Tyr-Ser-Phe-Thr-Gly-Lys-Met-Ile-Pro-Met-Ser-Arg-Leu-Glu-Asn-Tyr-Lys-Arg-Ile-Thr-Ser-Ser-Arg-Cys-Pro-Lys-Glu-Ala-Val-Val-Phe-Val-Thr-Lys-Leu-Lys-Arg-Glu-Ile-Cys-Ala-Asp-Pro-Asn-Lys-Glu-Trp-Val-Gln-Lys-Tyr-Ile-Arg-Lys-Leu-Asp-Gln-Asn-Gln-Val-Arg-Ser-Glu-Thr-Thr-Val-Phe-Tyr-Lys-Ile-Ala-Ser-Thr-Leu-Arg-Thr-Ser-Ala-Pro-Leu-Asn-Val-Asn-Leu-Thr-His-Lys-Ser-Glu-Ala-Asn-Ala-Ser-Thr-Leu-Phe-Ser-Thr-Thr-Thr-Ser-Ser-Thr-Ser-Val-Glu-Val-Thr-Ser-Met-Thr-Glu-Asn