CCL22   

GtoPdb Ligand ID: 4420

Comment: This is the mouse homolog of human CCL22.
Species: Mouse
Peptide Sequence
GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Gly-Pro-Tyr-Gly-Ala-Asn-Val-Glu-Asp-Ser-Ile-Cys-Cys-Gln-Asp-Tyr-Ile-Arg-His-Pro-Leu-Pro-Ser-Arg-Leu-Val-Lys-Glu-Phe-Phe-Trp-Thr-Ser-Lys-Ser-Cys-Arg-Lys-Pro-Gly-Val-Val-Leu-Ile-Thr-Val-Lys-Asn-Arg-Asp-Ile-Cys-Ala-Asp-Pro-Arg-Gln-Val-Trp-Val-Lys-Lys-Leu-Leu-His-Lys-Leu-Ser