CCL27   

GtoPdb Ligand ID: 4462

Comment: This is the mouse homolog of human CCL27.
Species: Mouse
Peptide Sequence
LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLN
LVLQKKMYSHPQQQN
Leu-Pro-Leu-Pro-Ser-Ser-Thr-Ser-Cys-Cys-Thr-Gln-Leu-Tyr-Arg-Gln-Pro-Leu-Pro-Ser-Arg-Leu-Leu-Arg-Arg-Ile-Val-His-Met-Glu-Leu-Gln-Glu-Ala-Asp-Gly-Asp-Cys-His-Leu-Gln-Ala-Val-Val-Leu-His-Leu-Ala-Arg-Arg-Ser-Val-Cys-Val-His-Pro-Gln-Asn-Arg-Ser-Leu-Ala-Arg-Trp-Leu-Glu-Arg-Gln-Gly-Lys-Arg-Leu-Gln-Gly-Thr-Val-Pro-Ser-Leu-Asn-Leu-Val-Leu-Gln-Lys-Lys-Met-Tyr-Ser-His-Pro-Gln-Gln-Gln-Asn