[125I]EGF (human)

Ligand id: 4848

Name: [125I]EGF (human)    

Peptide Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR