[125I]EGF (human)   

GtoPdb Ligand ID: 4848

Synonyms: [125I]-epidermal growth factor
   
Peptide Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR