GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence ![]() |
|
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Selected 3D Structures | ||
|
Post-translational Modification | |
Disulphide bond formation between cysteine residues at positions 13 and 80, 58 and 109, and 68 and 111 |