BDNF

Ligand id: 4872

Name: BDNF

Species: Human

Peptide Sequence
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC
RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Selected 3D Structures
PDB Id: 1BND
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 13 and 80, 58 and 109, and 68 and 111