BMP-10   Click here for help

GtoPdb Ligand ID: 4875

Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEP
ISILYLDKGVVTYKFKYEGMAVSECGCR
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 72 of each chain. Predicted disulphide bond formation between cysteine residues at positions 7 and 73, 36 and 105, and 40 and 107