GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: BMP-3A | bone morphogenetic protein 3A
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence ![]() |
|
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKM SSLSILFFDENKNVVLKVYPNMTVESCACR |
Selected 3D Structures | ||
|
Post-translational Modification | |
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 74. Disulphide bonds within each chain between cysteine resdiues at positions 8 and 77, 37 and 107, and 41 and 109;; predicted N-linked glycosylation of asparagine residue at position 101 |