GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

BMP-3   Click here for help

GtoPdb Ligand ID: 4882

Synonyms: BMP-3A | bone morphogenetic protein 3A
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKM
SSLSILFFDENKNVVLKVYPNMTVESCACR
Selected 3D Structures
PDB Id: 2QCQ
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 74. Disulphide bonds within each chain between cysteine resdiues at positions 8 and 77, 37 and 107, and 41 and 109;; predicted N-linked glycosylation of asparagine residue at position 101