B and T lymphocyte attenuator   Click here for help

GtoPdb Ligand ID: 4891

Abbreviated name: BTLA
Synonyms: B- and T-lymphocyte attenuator  | B- and T-lymphocyte-associated protein | CD272
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: BTLA is a negative immunomodulator. Interaction of BTLA with TNFRSF14 (HVEM) constitutes an immune checkpoint which inhibits T cell-mediated immune responses. Dysregulated BTLA expression contributes to immunosuppression and progression of some cancers [1-4] by enabling tumour immune evasion. Immunotherapeutics that target the BTLA-HVEM checkpoint offer potential as anti-tumour agents [5-6].
Species: Human
Peptide Sequence Click here for help
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDN
GSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSD
TAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSR
LARNVKEAPTEYASICVRS
Selected 3D Structures
PDB Id: 2aw2
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glcosylation of asparagine residues at positions 45, 64 and 80; disulphide bond formation between cysteine residues at positions 4 and 33, 28 and 85, and 42 and 49