B and T lymphocyte attenuator   Click here for help

GtoPdb Ligand ID: 4891

Abbreviated name: BTLA
Synonyms: B- and T-lymphocyte attenuator  | B- and T-lymphocyte-associated protein
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDN
GSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSD
TAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSR
LARNVKEAPTEYASICVRS
Selected 3D Structures
PDB Id: 2aw2
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glcosylation of asparagine residues at positions 45, 64 and 80; disulphide bond formation between cysteine residues at positions 4 and 33, 28 and 85, and 42 and 49