GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

cardiotrophin-like cytokine factor 1   Click here for help

GtoPdb Ligand ID: 4895

Abbreviated name: CLCF1
Comment: CLCF1 is an IL-6 family cytokine.
Species: Human
Is a component of
Peptide Sequence Click here for help
LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNY
EAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWL
LKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 2