GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ephrin-A3   Click here for help

GtoPdb Ligand ID: 4910

Abbreviated name: EFNA3
Synonyms: EFL-2 | EHK1 ligand | EPH-related receptor tyrosine kinase ligand 3
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins
Species: Human
Peptide Sequence Click here for help
QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNAS
QGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLP
QFTMGPNVKINVLEDFEGENPQVPKLEKSISG
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 41 and 88, and 77 and 136. Predicted amidation of C-terminal glycine residue; predicted N-linked glycosylation of asparagine residues at positions 16, 45 and 78