|
Abbreviated name: EFNA3
Synonyms: EFL-2 | EHK1 ligand | EPH-related receptor tyrosine kinase ligand 3
Compound class:
Endogenous peptide in human, mouse or rat
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins
Species: Human
|
Peptide Sequence  |
|
|
QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNAS QGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLP QFTMGPNVKINVLEDFEGENPQVPKLEKSISG |
|
| Post-translational Modification | |
| Predicted disulphide bond formation between cysteine residues at positions 41 and 88, and 77 and 136. Predicted amidation of C-terminal glycine residue; predicted N-linked glycosylation of asparagine residues at positions 16, 45 and 78 | |
