GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ephrin-A4   Click here for help

GtoPdb Ligand ID: 4911

Abbreviated name: EFNA4
Synonyms: EPH-related receptor tyrosine kinase ligand 4 | LERK-4
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins
Species: Human
Peptide Sequence Click here for help
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGH
VQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGES
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 33 and 74, and 61 and 119. Predicted amidation of C-terminal serine residue; predicted N-linked glycosylation of asparagine residue at position 8