|
Abbreviated name: EFNB2
Synonyms: LERK-5
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Ephrin B2 is a cell surface transmembrane ligand for Eph receptors (receptor tyrosine kinases, including EPHA4, EPHA3 and EPHB4). EFNB2 and EFNB3 are exploited for infection by the zoonotic henipaviruses, Nipah virus (NiV) and Hendra virus (HeV) [1-2]. These viruses emerged from bats during the 1990s and have since caused a number of deadly outbreaks in humans and domesticated animals. NiV and HeV infections in humans cause both neurological and respiratory symptoms. The WHO considers NiV as an emergong pathogen, with potential to cause infection of epidemic proportion. NiV has high mortality and morbidity rates and there is no effective anti-viral therapy.
Species: Human
|
Peptide Sequence  |
|
|
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQD IKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEA GTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTL SLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV |
|
| Post-translational Modification | |
| Tyrosine residues at positions 277, 284, 289 and 303 are phosphotyrosine. Serine residue at position 298 is phosphoserine. Disulphide bond formation between asparagine residues at positions 35 and 74, and 62 and 126; predicted N-linked glycosylation of asparagine residues at positions 9 and 112 | |
