GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

EGF   Click here for help

GtoPdb Ligand ID: 4916

Synonyms: urogastrone
Species: Human
Peptide Sequence Click here for help
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Selected 3D Structures
PDB Id: 2KV4
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 6 and 20, 14 and 31, and 33 and 42