epigen   Click here for help

GtoPdb Ligand ID: 4917

Abbreviated name: EPG
Synonyms: epithelial mitogen
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
AAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTS
YAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRCLKLKSPYNVCSGERRPL
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 15 and 19; predicted disulphide bonf formation between cysteine resdiues at positions 38 and 51, 46 and 62, and 64 and 73