epiregulin

Ligand id: 4918

Name: epiregulin

Species: Human

Peptide Sequence
VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
Val-Ala-Gln-Val-Ser-Ile-Thr-Lys-Cys-Ser-Ser-Asp-Met-Asn-Gly-Tyr-Cys-Leu-His-Gly-Gln-Cys-Ile-Tyr-Leu-Val-Asp-Met-Ser-Gln-Asn-Tyr-Cys-Arg-Cys-Glu-Val-Gly-Tyr-Thr-Gly-Val-Arg-Cys-Glu-His-Phe-Phe-Leu
Selected 3D Structures
PDB Id: 1K37
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 9 and 22, 17 and 33, and 35 and 44