FGF-2   Click here for help

GtoPdb Ligand ID: 4924

Synonyms: basic fibroblast growth factor (bFGF) | fibroblast growth factor 2 (FGF-2) | heparin-binding growth factor 2 (HBGF-2)
Comment: Monomer and homodimer
Species: Human
Peptide Sequence Click here for help
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDG
RLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Selected 3D Structures
PDB Id: 1bas
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Tyrosine residue at position 73 is phosphotyrosine