GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

FGF-7   Click here for help

GtoPdb Ligand ID: 4928

Synonyms: HBGF-7 | heparin-binding growth factor 7
Species: Human
Peptide Sequence Click here for help
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIK
GVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPM
AIT
Selected 3D Structures
PDB Id: 1qqk
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 14