growth/differentiation factor-1

Ligand id: 4936

Name: growth/differentiation factor-1

Abbreviated name: GDF1

Species: Human

Peptide Sequence
DAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQCALPVALSGSGGPPALNHAVLRALMHAAAPGAAD
LPCCVPARLSPISVLFFDNSDNVVLRQYEDMVVDECGCR
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 83 of each chain. Disulphide bond formation between cysteine residues at positions 14 and 84, 43 and 116, and 47 and 118