growth/differentiation factor-10

Ligand id: 4937

Name: growth/differentiation factor-10

Abbreviated name: GDF10

Species: Human

Peptide Sequence
QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKM
NSLGVLFLDENRNVVLKVYPNMSVDTCACR
Post-translational Modification
The active peptide is predicted to be either a homodimer or a heterodimer. Predicted interchain disulphide bond between cysteine residues at position 74 of each chain. Predicted N-linked glycosylation of asparagine residue at position 101; predicted disulphide bond formation between cysteine residues at positions 8 and 75, 37 and 107, and 41 and 109