Abbreviated name: GDF10
Synonyms: bone morphogenetic protein 3B (BMP-3B) | bone-inducing protein (BIP) | GDF-10
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence | |
QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKM NSLGVLFLDENRNVVLKVYPNMSVDTCACR |
Post-translational Modification | |
The active peptide is predicted to be either a homodimer or a heterodimer. Predicted interchain disulphide bond between cysteine residues at position 74 of each chain. Predicted N-linked glycosylation of asparagine residue at position 101; predicted disulphide bond formation between cysteine residues at positions 8 and 75, 37 and 107, and 41 and 109 |