growth/differentiation factor-3

Ligand id: 4938

Name: growth/differentiation factor-3

Abbreviated name: GDF3

Species: Human

Peptide Sequence
AAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCI
PTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG
Post-translational Modification
The active peptide is predicted to be either a homodimer or a heterodimer, which cannot be disulphide linked. Predicted N-linked glycosylation of asparagine residue at position 56; predicted disulphide bond formation between cysteine residues at positions 14 and 79, 43 and 111, and 47 and 113