Abbreviated name: GDF9
Synonyms: GDF-9
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence ![]() |
|
GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVH TMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR |
Post-translational Modification | |
The active peptide is predicted to be either a homodimer or a heterodimer, which cannot be disulphide linked. Predicted N-linked glycosylation of asparagine residue at position 19; predicted disulphide bond formation between cysteine residues at positions 34 and 100, 63 and 132, and 67 and 134 |