GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

growth hormone 2   Click here for help

GtoPdb Ligand ID: 4944

Abbreviated name: GH2
Species: Human
Peptide Sequence Click here for help
FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISL
LLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNY
GLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 53 and 165, and 182 and 189; predicted N-linked glycosylation on asparagine residue at position 140