HB-EGF

Ligand id: 4948

Name: HB-EGF

Species: Human

Peptide Sequence
DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER
CHGLSL
Selected 3D Structures
PDB Id: 1XDT
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
O-linked glycosylation of threonine residues at positions 13 and 23; predicted disulphide bond formation between cysteine residues at positions 46 and 59, 54 and 70, and 72 and 81