GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α10   Click here for help

GtoPdb Ligand ID: 4956

Synonyms: IFN alpha-10 | interferon alpha-10 | interferon alpha-6L | interferon alpha-C
Immunopharmacology Ligand
Comment: IFN-α10 is a type I IFN.
Species: Human
Peptide Sequence Click here for help
CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQS
LLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQK
RLRRKD
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 1 and 99, and 29 and 139