GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α17   Click here for help

GtoPdb Ligand ID: 4959

Synonyms: IFN alpha-17 | interferon alpha-17 | interferon alpha-88 | interferon alpha-T
Immunopharmacology Ligand
Comment: IFN-α17 is a type I IFN.
Species: Human
Peptide Sequence Click here for help
CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGLPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQS
LLEKFSTELYQQLNNLEACVIQEVGMEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQK
ILRRKD
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 1 and 99, and 29 and 139