GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α7   Click here for help

GtoPdb Ligand ID: 4965

Synonyms: IFN-alpha-7 | interferon alpha-7 | interferon alpha-J | interferon alpha-J1
Immunopharmacology Ligand
Comment: IFN-α7 is a type I IFN.
Species: Human
Peptide Sequence Click here for help
CDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQS
LLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTNLKK
GLRRKD
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 1 and 99, and 29 and 139