GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: hematopoietic growth factor | interleukin-13 | mast cell growth factor | multipotential colony-stimulating factor | P-cell-stimulating factor
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-13 shares sequence and structural homology with IL-4.
Species: Human
|
Peptide Sequence ![]() |
|
LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFC PHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Selected 3D Structures | ||
|
Post-translational Modification | |
Disulphide bond formation between cysteine residues at positions 38 and 66, and 54 and 80; predicted N-linked glycosylation of asparagine residues at positions 28, 39, 47 and 62 |