GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-13   Click here for help

GtoPdb Ligand ID: 4980

Synonyms: hematopoietic growth factor | interleukin-13 | mast cell growth factor | multipotential colony-stimulating factor | P-cell-stimulating factor
Immunopharmacology Ligand
Comment: IL-13 shares sequence and structural homology with IL-4.
Species: Human
Peptide Sequence Click here for help
LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFC
PHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Selected 3D Structures
PDB Id: 1ga3
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 38 and 66, and 54 and 80; predicted N-linked glycosylation of asparagine residues at positions 28, 39, 47 and 62