GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: cytokine Zcyto22 | IFN-lambda-3 | IFN-lambda-4 | interleukin-28B (IL-28B) | interleukin-28C (IL-28C)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-λ3 is a type III IFN.
Species: Human
|
Peptide Sequence ![]() |
|
VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALT LKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRL LTRDLNCVASGDLCV |
Post-translational Modification | |
Disulphide bonds between cysteine residues at positions 16 and 115, 50 and 148, and 167 and 174 |