GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-λ3   Click here for help

GtoPdb Ligand ID: 4992

Synonyms: cytokine Zcyto22 | IFN-lambda-3 | IFN-lambda-4 | interleukin-28B (IL-28B) | interleukin-28C (IL-28C)
Immunopharmacology Ligand
Comment: IFN-λ3 is a type III IFN.
Species: Human
Peptide Sequence Click here for help
VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALT
LKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRL
LTRDLNCVASGDLCV
Post-translational Modification
Disulphide bonds between cysteine residues at positions 16 and 115, 50 and 148, and 167 and 174