IFN-λ1

Ligand id: 4993

Name: IFN-λ1

Species: Human

Peptide Sequence
GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTL
KVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTR
DLKYVADGNLCLRTSTHPEST
Selected 3D Structures
PDB Id: 3OG4
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of aspragine residue at position 46; disulphide bond formation between cysteine residues at positions 49 and 145