IL-7

Ligand id: 4999

Name: IL-7

Species: Human

Peptide Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLL
KVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 2 and 141, 24 and 129, and 47 and 92, predicted N-linked glycosylation of asparagine residues at positions 70, 91 and 116