GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

leptin   Click here for help

GtoPdb Ligand ID: 5015

Species: Human
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: leptin

Peptide Sequence Click here for help
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDL
ENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Selected 3D Structures
PDB Id: 1AX8
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 96 and 146