Abbreviated name: NRTN
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Biologically active neurturin is a disulphide-linked homodimer
Species: Human
|
Peptide Sequence | |
ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS FLDAHSRYHTVHELSARECACV |
Post-translational Modification | |
Biologically active peptide is a homodimer. Predicted disulphide bond formation between cysteine residues at positions 8 and 70, 35 and 99, and 39 and 101. Interchain disulphide bond between cysteine residues at position 69 of each of the two chains |