oncostatin M   

GtoPdb Ligand ID: 5035

Abbreviated name: OSM
Comment: OSM is an IL-6 family cytokine.
Species: Human
Peptide Sequence
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGC
VLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAF
QRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR
Selected 3D Structures
PDB Id: 1EVS
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 75 and 192; disulphide bond formation between cysteine residues at positions 6 and 127, and 49 and 167