GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

prolactin   Click here for help

GtoPdb Ligand ID: 5049

Species: Human
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: prolactin

Peptide Sequence Click here for help
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDF
LSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMAD
EESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
Post-translational Modification
Partial N-linked glycosylation of asparagine residue at positon 31; disulphide bonmds between cysteine residues at positions 4 and 11, 58 and 174, and 191 and 199