Synonyms: cetermin | glioblastoma-derived T-cell suppressor factor (G-TSF) | polyergin | TGF-beta-2 | transforming growth factor beta-2
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence ![]() |
|
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVS QDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
Selected 3D Structures | ||
|
Post-translational Modification | |
The active form of the peptide is a disulphide linked homodimer, with the bond between cysteine residues at position 77. Disulphide bonds between cysteine residues at positions 7 and 16, 15 and 78, 44 and 109, and 48 and 111 |